| Western result: +/- | | | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: cTBP CBI Antibody Core Code: A0598 "Lot" Number: 2 Position: 100(151-250) % Identical Homology of Target to Mouse Protein: 100% (NP_038712.1| TATA box binding protein) Molecular Weight of fusion protein: 38 KDa Target sequence used to make this antibody: RNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSE
EQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFP
IRLEGLVLTHQQFSSYEPEL
| | Sequence Name: cTBP Full name: TBP [Gallus gallus] UniGene Number: N.A. Accession Number: BAA20298 Source organism: chicken ( Gallus gallus ) Full length size (aa): 302 NCBI information page: click here Full length sequence: MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPVQSTNSLS
ILEEQQRQQQQQQAAQSSTSQQATQGTSGQTPQLFHSQTLTTAPLPGTTP
LYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRA
RNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKY
ARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPEL
FPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
TT
|