Return to CBI Antibody Core Home Page
  Return to others list
    Return to Phage lambda list


Phage lambda
v


Antibody Name/Abbreviation: Cro
CBI Antibody Core Code: A1388

"Lot" Number: 1 Position: 66 (1-66)
% Identical Homology of Target to Mouse Protein: 43% (XP_181295.3| RIKEN cDNA 1700012F10)
Molecular Weight of fusion protein: 21.26 KDa

Target sequence used to make this antibody:
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKI
FLTINADGSVYAEEVKPFPSNKKTTA






Sequence Name: v
Full name:
UniGene Number: N.A.
Accession Number: P03040
Source organism: Phage lambda
Full length size (aa): 66
NCBI information page:

Full length sequence:
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsv
yaeevkpfpsnkktta





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.