| Western result: +/- | | GST
 | GST-Tin; NK-4 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: Tin; NK-4 CBI Antibody Core Code: A0661 "Lot" Number: 1 Position: 100(60-159) % Identical Homology of Target to Mouse Protein: 34% (NP_075633.1| non-POU-domain-containing, octamer binding protein; non-POU-domain-containing, octamer-binding protein) Molecular Weight of fusion protein: 38 KDa Target sequence used to make this antibody: IDGAATASALFAAGEYQNPHQYLNHQQHQQSELPIPQQQL
HHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMF
QHHHGHPHQSFQHSASAYNM
| | Sequence Name: Tin; NK-4 Full name: MUSCLE-SPECIFIC HOMEOBOX PROTEIN TINMAN (MSH-2) (NK-4), Tinman UniGene Number: N.A. Accession Number: P22711 Source organism: fruit fly ( Drosophila melanogaster ) Full length size (aa): 416 NCBI information page: click here Full length sequence: MLQHHQQQAQSGGYYDHYTQSPSPGSLTNADALNTTPFSVKDILNMVNQT
EAYEGSYGHIDGAATASALFAAGEYQNPHQYLNHQQHQQSELPIPQQQLH
HQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSF
QHSASAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGATPSAVDI
KSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNS
SSLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRM
KRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQ
NRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIPNHVMWPPTMQQS
QQQQQHHAQQQQMQHM
|