fruit fly ( Drosophila melanogaster )
dTAF10

Western result: +

GST GST-dTAF10 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: dTAF10
CBI Antibody Core Code: A0335
"Lot" Number: 1 Position: 100(68-167)
% Identical Homology of Target to Mouse Protein: 55% (NP_064408.2| TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30 kDa; TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30 kDa)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
SPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFISDI
ANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAME
DLVPALADHGITMRKPQYFV

Sequence Name: dTAF10
Full name: TATA binding protein asssociated factor 24kDa (or dTAFII24)
UniGene Number: N.A.
Accession Number: DME243836
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 167
NCBI information page: click here

Full length sequence:
MASDGEDISVTPAESVTSATDTEEEDIDSPLMQSELHSDEEQPDVEEVPL
TTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSA
QKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLV
PALADHGITMRKPQYFV