Return to CBI Antibody Core Home Page
  Return to Drosophila list
    Return to fruit fly ( Drosophila melanogaster ) list


fruit fly ( Drosophila melanogaster )
amnesiac


Antibody Name/Abbreviation: amn
CBI Antibody Core Code: A1470

"Lot" Number: 1 Position: 40 (136-175)
% Identical Homology of Target to Mouse Protein: 38% (NP_058027.1| synapse-associated protein 102; discs large homolog 3)
Molecular Weight of fusion protein: 18.4 KDa

Target sequence used to make this antibody:
DSETKVLTKWPSCSLIGRRSVPRGQPKFSRENPRALSPSL






Sequence Name: amnesiac
Full name:
UniGene Number: N.A.
Accession Number: NM_078692
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 180
NCBI information page: click here

Full length sequence:
MRSFCCCFYPAAVALHCVLLFYTFFLLFRASALRRRVVSGSKGSAALALC
RQFEQLSASRRERAEECRTTQLRYHYHRNGAQSRSLCAAVLCCKRSYIPR
PNFSCFSLVFPVGQRFAAARTRFGPTLVASWPLCNDSETKVLTKWPSCSL
IGRRSVPRGQPKFSRENPRALSPSLLGEMR





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.