fruit fly ( Drosophila melanogaster )
CG1221

Western result: +

GST GST-CG1221 A1037a (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: CG1221
CBI Antibody Core Code: A1037a
"Lot" Number: 1 Position: 100 (79-178)
% Identical Homology of Target to Mouse Protein: 30% (NP_032999.1| pleiotrophin; osteoblastic cell factor; heparin-binding brain mitogen; heparin-binding growth factor 8; heparin affin regulatory peptide; heparin-binding neurotorphic factor; heparin-binding neurite promoting factor; heparin-binding growth-as)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
GKNPWTECDTKTNTRSRTLTLKKGDPACDQTRTIQKKCKK
ACRYEKGSWSECATGQMTRADKLKASSDPSCEATRVIKKN
CKPGKSKDKSAKEQRKNIDK

Antibody Name/Abbreviation: CG1221
CBI Antibody Core Code: A1037b
"Lot" Number: 1 Position: 20 (159-178)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
CKPGKSKDKSAKEQRKNIDK

Sequence Name: CG1221
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 185
NCBI information page:

Full length sequence:
MRINCNALFLASLVTWSGVMCSTVLGTTEGQETPLALPVAEQTQPTTAIQ
GEVWEEDDHEVLIRNERGTKSDGLSCRYGKNPWTECDTKTNTRSRTLTLK
KGDPACDQTRTIQKKCKKACRYEKGSWSECATGQMTRADKLKASSDPSCE
ATRVIKKNCKPGKSKDKSAKEQRKNIDKAARKGRV