Return to CBI Antibody Core Home Page
  Return to Drosophila list
    Return to fruit fly ( Drosophila melanogaster ) list


fruit fly ( Drosophila melanogaster )
CG18321


Links to multiple antibodies on this page for CG18321:
CG18321
CG18321


Western result: +
GST
GST-CG18321
A1036a
(fragment)

25 kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: CG18321
CBI Antibody Core Code: A1036a

"Lot" Number: 1 Position: 100 (57-156)
% Identical Homology of Target to Mouse Protein: 31% (NP_891984.1| protein phosphatase 4, regulatory subunit 2)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
AETVASTTNSDTHRTRNNRKPNKPQEHSQQVGAHKSGSRK
LVVAENGGALSSQLPQPNHKQGHKNTDKQQRGGGSKQQRG
HSQHHGGNRKGPKAATPENG







Western result: +
control
CG18321
A1036b
(fragment)

32.2 kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: CG18321
CBI Antibody Core Code: A1036b

"Lot" Number: 1 Position: 20 (254-273)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
GGKQHGQSRRTKEQKQKDKG






Sequence Name: CG18321
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 279
NCBI information page:

Full length sequence:
MNLILALTTALHLVLVVLAHNPLSTRGESLSDGIRLVMEKRSGDVVHIRP
ARGTLEAETVASTTNSDTHRTRNNRKPNKPQEHSQQVGAHKSGSRKLVVA
ENGGALSSQLPQPNHKQGHKNTDKQQRGGGSKQQRGHSQHHGGNRKGPKA
ATPENGSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQNCLPTRTIQKKCK
KGCRYEKGEWSQCVGGQITREDKLEPEATGGSDQNCNPVRTVSKKCKANG
NSSGGKQHGQSRRTKEQKQKDKGASHISS





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.