fruit fly ( Drosophila melanogaster )
muscleblind

Western result: +

control mbl A1019b (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: mbl
CBI Antibody Core Code: A1019b
"Lot" Number: 1 Position: 20 (159-178)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
PVVPQTVQVAQQKIPRSDRL

Antibody Name/Abbreviation: mbl
CBI Antibody Core Code: A1019a
"Lot" Number: 1 Position: 100 (1-100)
% Identical Homology of Target to Mouse Protein: 66% (NP_064391.2| muscleblind-like 1; muscleblind-like (Drosophila))
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
MANVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECK
FAHPPANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQ
HLKDQLLINGRNHLALKNAL

Sequence Name: muscleblind
Full name: muscleblind
UniGene Number: N.A.
Accession Number: gi:20455041
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 297
NCBI information page:

Full length sequence:
MANVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEV
QNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLKDQLLINGRNHLALKNAL
MQQMGIAPGQPVISGQVPAVATNPYLTGIPANSYSPYYTTGHLVPALLGP
DPVTSQLGPVVPQTVQVAQQKIPRSDRLETSPLAAHHHQQQQQLQHQLNN
INNNNNHSTAGAAATSTTATTTTNNAAAAAAAAAAAAAAAVMGHHTLEVG
KKRAADTTDMFPLVFFCSFPSPCVFAFLNCSIFGFLRLWFSLFNLRH