Links to multiple antibodies on this page for GRHR-b: GRHR GRHR-b Western result: + | | control
 | GRHR A1006a (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: GRHR CBI Antibody Core Code: A1006a "Lot" Number: 1 Position: 20 (5-24) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: 29.2 KDa Target sequence used to make this antibody: AEENDHRDLSNWSNVNDTNG
Western result: + | | GST
 | GST-GRHR-b A1006b (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: GRHR-b CBI Antibody Core Code: A1006b "Lot" Number: 1 Position: 49 (320-368) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of fusion protein: 19.39 KDa Target sequence used to make this antibody: GLYNIRGRMNNNNPSVNNRHTSLSNRLDSSNQLMQKQLTN
NSLLNGRGQ
| | Sequence Name: GRHR-b Full name: UniGene Number: N.A. Accession Number: PIR:JE0278 Source organism: fruit fly ( Drosophila melanogaster ) Full length size (aa): 443 NCBI information page: Full length sequence: MAKVAEENDHRDLSNWSNVNDTNGTIHLTKDMVFNDGHRLSITVYSILFV
ISTIGNSTVLYLLTKRRLRGPLRIDIMLMHLAIADLMVTLLLMPMEIVWA
WTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLKRSYN
RGRIMLACAWLGSVVCSIPQAFLFHLEEHPAVTGYFQCVIFSSFRSDFDE
KLYQAASMCSMYAFPLIMFIYCYGAIYLEIYRKSQRVLKDVIAERFRRSN
DDVLSRAKKRTLKMTITIVIVFIICWTPYYTISMWYWLDKHSAGKINPLL
RKALFIFASTNSCMNPLVYGLYNIRGRMNNNNPSVNNRHTSLSNRLDSSN
QLMQKQLTNNSLLNGRGQVMAAAVSATTKLANVVSLKGNANGNGSAAAAG
TVPITPPLTVTIAPLATDDEANDDSCLSAVTIRCQDQSPIRQK
|