fruit fly ( Drosophila melanogaster )
GRHR-b

Western result: +

control GRHR A1006a (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: GRHR
CBI Antibody Core Code: A1006a
"Lot" Number: 1 Position: 20 (5-24)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
AEENDHRDLSNWSNVNDTNG

Western result: +

GST GST-GRHR-b A1006b (fragment)

19.39 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: GRHR-b
CBI Antibody Core Code: A1006b
"Lot" Number: 1 Position: 49 (320-368)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of fusion protein: 19.39 KDa

Target sequence used to make this antibody:
GLYNIRGRMNNNNPSVNNRHTSLSNRLDSSNQLMQKQLTN
NSLLNGRGQ

Sequence Name: GRHR-b
Full name:
UniGene Number: N.A.
Accession Number: PIR:JE0278
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 443
NCBI information page:

Full length sequence:
MAKVAEENDHRDLSNWSNVNDTNGTIHLTKDMVFNDGHRLSITVYSILFV
ISTIGNSTVLYLLTKRRLRGPLRIDIMLMHLAIADLMVTLLLMPMEIVWA
WTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLKRSYN
RGRIMLACAWLGSVVCSIPQAFLFHLEEHPAVTGYFQCVIFSSFRSDFDE
KLYQAASMCSMYAFPLIMFIYCYGAIYLEIYRKSQRVLKDVIAERFRRSN
DDVLSRAKKRTLKMTITIVIVFIICWTPYYTISMWYWLDKHSAGKINPLL
RKALFIFASTNSCMNPLVYGLYNIRGRMNNNNPSVNNRHTSLSNRLDSSN
QLMQKQLTNNSLLNGRGQVMAAAVSATTKLANVVSLKGNANGNGSAAAAG
TVPITPPLTVTIAPLATDDEANDDSCLSAVTIRCQDQSPIRQK