Return to CBI Antibody Core Home Page
  Return to other mammals list
    Return to Cow (Bovine) ( Bos taurus ) list


Cow (Bovine) ( Bos taurus )
GRO-alpha


Antibody Name/Abbreviation: GRO-alpha
CBI Antibody Core Code: A0431

"Lot" Number: 1 Position: 20(60-79)
% Identical Homology of Target to Mouse Protein: 80% (NP_976065.1| gene model 1960; dendritic cell inflammatory protein 1)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
TTPGPHCDQTEVIASLKTGQ






Sequence Name: GRO-alpha
Full name: GRO-alpha
UniGene Number: N.A.
Accession Number: U95812
Source organism: Cow (Bovine) ( Bos taurus )
Full length size (aa): 104
NCBI information page: click here

Full length sequence:
MAPAATAAAPRLLRAAMLFLLLVAAGRRAAGAPVVNELRCQCLQTLQGIH
LKNIQSVKVTTPGPHCDQTEVIASLKTGQEVCLNPTAPMVKKIIDKMLNK
ASAN





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.