Links to multiple antibodies on this page for sialoprotein: BSPII BSPII BSPII BSPII Antibody Name/Abbreviation: BSPII CBI Antibody Core Code: A1266d "Lot" Number: 1 Position: 17(229-245) % Identical Homology of Target to Mouse Protein: 64% (NP_032344.1| integrin binding sialoprotein; bone sialoprotein II) Molecular Weight of GST-fusion: 31.87 KDa Target sequence used to make this antibody: GFKPTTPHQEVYGTTPP
Antibody Name/Abbreviation: BSPII CBI Antibody Core Code: A1266a "Lot" Number: 1 Position: 285(26-310) % Identical Homology of Target to Mouse Protein: 34% (NP_032344.1| integrin binding sialoprotein; bone sialoprotein II) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: To be posted
Antibody Name/Abbreviation: BSPII CBI Antibody Core Code: A1266b "Lot" Number: 1 Position: 61(90-150) % Identical Homology of Target to Mouse Protein: 62% (NP_032462.1| K+ voltage-gated channel, subfamily S, 2) Molecular Weight of fusion protein: 20.71 KDa Target sequence used to make this antibody: GNNGGNEDSDENEDEESEAENTTLSTTTLGYGEITPGTGD
IGLAAIWLPRKAGATGKKATK
Antibody Name/Abbreviation: BSPII CBI Antibody Core Code: A1266c "Lot" Number: 1 Position: 54(201-254) % Identical Homology of Target to Mouse Protein: 45% (NP_032344.1| integrin binding sialoprotein; bone sialoprotein II) Molecular Weight of fusion protein: 19.94 KDa Target sequence used to make this antibody: EDGEEESVTEANTEGITVAGETTTSPNGGFKPTTPHQEVY
GTTPPPFGKITTPG
| Sequence Name: sialoprotein Full name: UniGene Number: N.A. Accession Number: aab30817 Source organism: Cow (Bovine) ( Bos taurus ) Full length size (aa): 310 NCBI information page: Full length sequence: MKTVLILLSILGMACALSMKNLNRRAKLEDSEENGVFKYRPQYYVYKHGY
FYPALKRFAVQSSSDSSEENGNGDSSEEEEEEEETSNEEGNNGGNEDSDE
NEDEESEAENTTLSTTTLGYGEITPGTGDIGLAAIWLPRKAGATGKKATK
EDESDEEEEEEEEEENEAEVDDNEQGINGTSSNSTEVDNGHGSSGGDNGE
EDGEEESVTEANTEGITVAGETTTSPNGGFKPTTPHQEVYGTTPPPFGKI
TTPGEYEQTGTNEYDNGYEIYESENGDPRGDNYRAYEDEYSYYKGRGYDS
YDGQDYYSHQ^
|