Tobacco Rattle Virus (TRV) ( Tobacco rattle tobravirus )
TRV 16k

Antibody Name/Abbreviation: TRV 16k
CBI Antibody Core Code: A0564
"Lot" Number: 2 Position: 100 (42-141)
% Identical Homology of Target to Mouse Protein: 34% (XP_139476.3| similar to calcium channel, voltage-dependent, T type, alpha 1I subunit; low voltage-activated T-type calcium channel alpha-1 subunit; low voltage-activated T-type calcium channel alpha-1 subunit (CACNA1I))
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
CAENNCGWFVCVVINDFTFDVYNCCGRSHLEKCRKRVETR
NREIWKQIRRNQAENMSATAKKSHNSKTSKKKFKEDREFG
TPKRFLRDDVPFGIDRLFAF

Other western:
Code: A0564
Lot: 1

Western result: +++

GST GST-TRV 16k (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Sequence Name: TRV 16k
Full name:
UniGene Number: N.A.
Accession Number: AAG46034
Source organism: Tobacco Rattle Virus (TRV) ( Tobacco rattle tobravirus )
Full length size (aa): 141
NCBI information page: click here

Full length sequence:
MTCVLKGCVNEVTVLGHETCSIGHANKLRKQVADMVGVTRRCAENNCGWF
VCVVINDFTFDVYNCCGRSHLEKCRKRVETRNREIWKQIRRNQAENMSAT
AKKSHNSKTSKKKFKEDREFGTPKRFLRDDVPFGIDRLFAF