| Antibody Name/Abbreviation: HCV-1b p7 CBI Antibody Core Code: A0049 "Lot" Number: 1 Position: 20(17-36) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: ADGILSFLVFFCAAWYIKGR
| | Sequence Name: HCV-1b p7 Full name: UniGene Number: N.A. Accession Number: N.A. Source organism: HCV (Hepatitis C) Full length size (aa): 65 NCBI information page: Full length sequence: AALENLVVLNAASLAGADGILSFLVFFCAAWYIKGRLVPGAAYALYGVWP
LLLLLLALPPRAYAM
|