Return to CBI Antibody Core Home Page
  Return to biothreat/emerging pathogens list
    Return to HCV (Hepatitis C) list


HCV (Hepatitis C)
HCV-1b p7


Antibody Name/Abbreviation: HCV-1b p7
CBI Antibody Core Code: A0049

"Lot" Number: 1 Position: 20(17-36)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
ADGILSFLVFFCAAWYIKGR






Sequence Name: HCV-1b p7
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: HCV (Hepatitis C)
Full length size (aa): 65
NCBI information page:

Full length sequence:
AALENLVVLNAASLAGADGILSFLVFFCAAWYIKGRLVPGAAYALYGVWP
LLLLLLALPPRAYAM





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.