corn (Z. mays) ( Zea mays )
ABPHYL1

Western result: +

control ABPHYL1Pep2-test A0980 (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: ABPHYL1Pep2-test
CBI Antibody Core Code: A0980
"Lot" Number: 1 Position: 20 (116-135)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
FLLKPVRPSDVSRLCSRVLR

Antibody Name/Abbreviation: ABPHYL1
CBI Antibody Core Code: A0186
"Lot" Number: 2 Position: 135(1-135)
% Identical Homology of Target to Mouse Protein: 26% (XP_484619.1| similar to RAS and EF hand domain containing; RAB45, member RAS oncogene family)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
MASRKCLGGEGSAPAPHVLAVDDSSVDRAVIAGILRSSQF
RVTAVDSGKRALELLGTEPNVSMIITDYWMPEMTGYELLK
KIKESSRLKEIPVVIMSSENVPTRINRCLEEGAEDFLLKP
VRPSDVSRLCSRVLR

Sequence Name: ABPHYL1
Full name: Zea mays ZmRR3 for response regulator
UniGene Number: N.A.
Accession Number: AB042260
Source organism: corn (Z. mays) ( Zea mays )
Full length size (aa): 135
NCBI information page: click here

Full length sequence:
MASRKCLGGEGSAPAPHVLAVDDSSVDRAVIAGILRSSQFRVTAVDSGKR
ALELLGTEPNVSMIITDYWMPEMTGYELLKKIKESSRLKEIPVVIMSSEN
VPTRINRCLEEGAEDFLLKPVRPSDVSRLCSRVLR