Return to CBI Antibody Core Home Page
  Return to others list
    Return to Sulfolobus solfataricus list


Sulfolobus solfataricus
aBTF


Antibody Name/Abbreviation: aBTF
CBI Antibody Core Code: A0820

"Lot" Number: 1 Position: 20(56-75)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
IYGGQTREEKKQSQIEIKDE






Sequence Name: aBTF
Full name: SSO0385
UniGene Number: N.A.
Accession Number: N.A.
Source organism: Sulfolobus solfataricus
Full length size (aa): 116
NCBI information page:

Full length sequence:
MAKIKPSDLKKMERMGIKTEQINATRVIIETNEKNIVIENPTVMKTNVMG
NEAIVIYGGQTREEKKQSQIEIKDEDVKFVAEQTGKSEKDAREALVKANG
DIAKAIMILQGETSNP





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.