Streptococcus pneumoniae R6
SPR1404 (sprCHP)

Western result: +

GST GST-SPR1404 (sprCHP) (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: SPR1404 (sprCHP)
CBI Antibody Core Code: A0361
"Lot" Number: 2 Position: 100(141-240)
% Identical Homology of Target to Mouse Protein: 40% (XP_487596.1| similar to L-lactate dehydrogenase A chain (LDH-A) (LDH muscle subunit) (LDH-M))
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
QIELSFTPSEIRGNEIDIRYFFAQYFSERYYFLDWPFPDL
PEEDLTEFADFFYKITNYPMRFSIYRMYKLMIAISIHRVK
NGHFIDLPNHFYKEYYPLLK

Other western:
Code: A0361
Lot: 1

Western result: -

GST GST-SPR1404 (sprCHP) (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Sequence Name: SPR1404 (sprCHP)
Full name: Conserved hypothetical protein
UniGene Number: N.A.
Accession Number: AAL00208
Source organism: Streptococcus pneumoniae R6
Full length size (aa): 502
NCBI information page: click here

Full length sequence:
MNYGGNTRMRNLLSTKVQRQLRLMETLIQNRNWMKLHELAEKLGCTERIL
KSDLNELRIAFPSINIQSSVNGIMIDLEVNTSVEDIYQYFLANSQSFQLL
EYMFFNEGLPIYRTIENLYFSSANLYRLGRNITKVLSSQFQIELSFTPSE
IRGNEIDIRYFFAQYFSERYYFLDWPFPDLPEEDLTEFADFFYKITNYPM
RFSIYRMYKLMIAISIHRVKNGHFIDLPNHFYKEYYPLLKSIPNFQETLA
YFSKHFGLEMTPDTIAQIFISFLQNDIFLDPQEFFNSLEDNSQARYSYQL
LSQILEGLSKQYKITFTNHDELIWHLHNTAFFERQEIFSTPILFEQKALT
IKKFEVYFPDFMGSARQELAQYRQAIGQHDHPEQLEHLMYTILTHAENLS
TQLLENRPPIKVLIISNFDHAISLTFVDMLSYYCNNRFTFDIWDELKTSP
EILNQTDYDIIVSNFYIPGITKKFICRNHLSIMNLVNHLNTLSNEIHLSN
TL