| Antibody Name/Abbreviation: Thioredoxin CBI Antibody Core Code: 1Ab090 "Lot" Number: 1 Position: To be posted % Identical Homology of Target to Mouse Protein: 100% Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: To be posted
| | Sequence Name: Thioredoxin Full name: UniGene Number: N.A. Accession Number: X77585 Source organism: mouse ( Mus musculus ) Full length size (aa): To be posted NCBI information page: click here Full length sequence: MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYS
NVVFLEVDVDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEAS
ITEYA
|