mouse ( Mus musculus )
mRIKEN

Western result: +

GST GST-mRIKEN (fragment)

37.78 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: mRIKEN
CBI Antibody Core Code: A0357
"Lot" Number: 2 Position: 98(1-98)
% Identical Homology of Target to Mouse Protein: 29% (NP_079979.2| RIKEN cDNA 3930402F23)
Molecular Weight of fusion protein: 37.78 KDa

Target sequence used to make this antibody:
MQKSCNEKEGKPKGSEAKREDEQPCGALEGQRLEGNFRQR
LLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLR
KKFRALHSNRTHSRDHPF

Sequence Name: mRIKEN
Full name: RIKEN1110018p05; mRIKEN cDNA 1110018p05
UniGene Number: N.A.
Accession Number: XM_136051
Source organism: mouse ( Mus musculus )
Full length size (aa): 98
NCBI information page: click here

Full length sequence:
MQKSCNEKEGKPKGSEAKREDEQPCGALEGQRLEGNFRQRLLQSLEEFKE
DIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSNRTHSRDHPF