Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
Rheb


Antibody Name/Abbreviation: Rheb
CBI Antibody Core Code: A0781

"Lot" Number: 1 Position: 20(165-184)
% Identical Homology of Target to Mouse Protein: 100% (NP_444305.2| RAS-homolog enriched in brain)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
LEAEKIDGAASQGKSSCSVM






Sequence Name: Rheb
Full name: RAS-homolog enriched in brain
UniGene Number: N.A.
Accession Number: BC012273
Source organism: mouse ( Mus musculus )
Full length size (aa): 184
NCBI information page: click here

Full length sequence:
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVN
GQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH
GKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSA
KENQTAVDVFKRIILEAEKIDGAASQGKSSCSVM





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.