Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
Pur B



Western result: +
control
Pur B
(fragment)

N.A. kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: Pur B
CBI Antibody Core Code: A0568

"Lot" Number: 1 Position: 23(296-318)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
ERQRDKLYERRGGGSGGGDESEG






Sequence Name: Pur B
Full name: purine rich element binding protein B
UniGene Number: N.A.
Accession Number: NP_035351
Source organism: mouse ( Mus musculus )
Full length size (aa): 324
NCBI information page: click here

Full length sequence:
MADGDSGSERGGGGGGGGGPGGFQPAPRGGGGGGGGPGGEQETQELASKR
LDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLG
DFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKEN
QRGRFLRIRQTVNRGGGGFGGGPGPGGLQSGQTIALPAQGLIEFRDALAK
LIDDYGGDEDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGC
NKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRD
KLYERRGGGSGGGDESEGEEVDED





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.