mouse ( Mus musculus )
Lrp2

Western result: +

GST GST-Lrp2 (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Lrp2
CBI Antibody Core Code: A0653
"Lot" Number: 2 Position: 100(87-186)
% Identical Homology of Target to Mouse Protein: 79% (XP_130308.3| similar to low density lipoprotein receptor-related protein 2; glycoprotein 330; low density lipoprotein-related protein 2; megalin)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
VPENVENQNYGRSIDPSEIVPEPKPASPGADETQGTKWNI
FKRKPKQTTNFENPIYAEMDTEQKEAVAVAPPPSPSLPAK
ASKRSSTPGYTATEDTFKDT

Other western:
Code: A0653
Lot: 1

Western result: +

GST GST-Lrp2 (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Sequence Name: Lrp2
Full name: low density lipoprotein receptor-related protein 2
UniGene Number: Mm.23847
Accession Number: AF197160
Source organism: mouse ( Mus musculus )
Full length size (aa): 196
NCBI information page: click here

Full length sequence:
LSSLAKPSENGNGVTFRSGADVNMDIGVSPFGPETIIDRSMAMNEQFVME
VGKQPVIFENPMYAAKDSTSKVGLAVQGPSVSSQVTVPENVENQNYGRSI
DPSEIVPEPKPASPGADETQGTKWNIFKRKPKQTTNFENPIYAEMDTEQK
EAVAVAPPPSPSLPAKASKRSSTPGYTATEDTFKDTANLVKEDSDV