| Western result: + | | GST
 | GST-mIgG2bCh-M (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: mIgG2bCh-M CBI Antibody Core Code: A0252 "Lot" Number: 3 Position: 100(101-200) % Identical Homology of Target to Mouse Protein: 86% (NP_997616.1| expressed sequence AU044919; gamma-2b-immunoglobulin) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: GPISTINPCPPCKECHKCAPNLEGGPSVFIFPPNIKDVLM
ISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTH
REDYNSTIRVVSTLPIQHQD
| | Sequence Name: mIgG2bCh-M Full name: IgG2b heavy chain, constent region UniGene Number: N.A. Accession Number: A02359 Source organism: mouse ( Mus musculus ) Full length size (aa): 335 NCBI information page: click here Full length sequence: AKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSV
HTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
GPISTINPCPPCKECHKCAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCV
VVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQD
WMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKD
VSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNM
KTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
|