mouse ( Mus musculus )
mGDI-beta-C

Western result: +

GST GST-mGDI-beta-C (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: mGDI-beta-C
CBI Antibody Core Code: A0256
"Lot" Number: 2 Position: 100(101-200)
% Identical Homology of Target to Mouse Protein: 100% (NP_031512.1| Rho, GDP dissociation inhibitor (GDI) beta)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
KEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATF
MVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDD
DKQDHLTWEWNLAIKKDWTE

Sequence Name: mGDI-beta-C
Full name: Rho, GDH dissociation inhibitor
UniGene Number: N.A.
Accession Number: BC031763
Source organism: mouse ( Mus musculus )
Full length size (aa): 200
NCBI information page: click here

Full length sequence:
MTEKDAQPQLEEADDDLDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKT
LLGDVPVVADPTVPNVTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVL
KEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPE
EYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDWTE