| Antibody Name/Abbreviation: Fn14 CBI Antibody Core Code: A0502 "Lot" Number: 1 Position: 100(30-129) % Identical Homology of Target to Mouse Protein: 71% (NP_038777.1| tumor necrosis factor receptor superfamily, member 12a; fibroblast growth factor regulated protein 2; type I transmembrane protein Fn14) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: APGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAA
APPAHFRLLWPILGGALSLVLVLALVSSFLVWRRCRRREK
FTTPIEETGGEGCPGVALIQ
| | Sequence Name: Fn14 Full name: UniGene Number: N.A. Accession Number: AK005530 Source organism: mouse ( Mus musculus ) Full length size (aa): 129 NCBI information page: click here Full length sequence: MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM
DCASCPARPHSDFCLGCAAAPPAHFRLLWPILGGALSLVLVLALVSSFLV
WRRCRRREKFTTPIEETGGEGCPGVALIQ
|