mouse ( Mus musculus )
EBP50

Western result: +-

GST GST-EBP50 A0511 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: EBP50
CBI Antibody Core Code: A0511
"Lot" Number: 1 Position: 100(151-250)
% Identical Homology of Target to Mouse Protein: 100% (NP_036160.1| solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; sodium-hydrogen exchanger regulatory factor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
TMKKGPNGYGFNLHSDKSKPGQFIRAVDPDSPAEASGLRA
QDRIVEVNGVCMEGKQHGDVVSAIKGGGDEAKLLVVDKET
DEFFKKCKVIPSQEHLDGPL

Western result: +

control EBP50-pep A0512 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: EBP50-pep
CBI Antibody Core Code: A0512
"Lot" Number: 1 Position: 20(152-171)
% Identical Homology of Target to Mouse Protein: 100% (NP_036160.1| solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; sodium-hydrogen exchanger regulatory factor)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
MKKGPNGYGFNLHSDKSKPG

Antibody Name/Abbreviation: EBP50-4
CBI Antibody Core Code: A0517
"Lot" Number: 1 Position: 10(343-352)
% Identical Homology of Target to Mouse Protein: 100% (NP_036160.1| solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; sodium-hydrogen exchanger regulatory factor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
MDWSKKNELF

Antibody Name/Abbreviation: EBP50-3
CBI Antibody Core Code: A0516
"Lot" Number: 1 Position: 28(291-318)
% Identical Homology of Target to Mouse Protein: 57% (NP_036160.1| solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; sodium-hydrogen exchanger regulatory factor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
ELNSQDSPKRQVSTEPSSTSSSSSDPIL

Antibody Name/Abbreviation: EBP50-C
CBI Antibody Core Code: A0513
"Lot" Number: 1 Position: 100(252-351)
% Identical Homology of Target to Mouse Protein: 62% (NP_036160.1| solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; sodium-hydrogen exchanger regulatory factor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
EPFSNGEIQKESSREALVEPASESPRPALARSASSDTSEE
LNSQDSPKRQVSTEPSSTSSSSSDPILDLNISLAVAKERA
HQKRSSKRAPQMDWSKKNEL

Antibody Name/Abbreviation: EBP50-1
CBI Antibody Core Code: A0514
"Lot" Number: 1 Position: 13(252-264)
% Identical Homology of Target to Mouse Protein: 100% (NP_036160.1| solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; sodium-hydrogen exchanger regulatory factor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
EPFSNGEIQKESS

Antibody Name/Abbreviation: EBP50-2
CBI Antibody Core Code: A0515
"Lot" Number: 1 Position: 11(271-281)
% Identical Homology of Target to Mouse Protein: 100% (NP_036160.1| solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 1; sodium-hydrogen exchanger regulatory factor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
PASESPRPALA

Sequence Name: EBP50
Full name: protein co-factor
UniGene Number: N.A.
Accession Number: U74079
Source organism: mouse ( Mus musculus )
Full length size (aa): 355
NCBI information page: click here

Full length sequence:
MSADAAAGEPLPRLCCLEKGPNGYGFHLHGEKGKVGQFIRLVEPGSPAEK
SGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDERLK
KLGVSIREELLRPQEKSEQAEPPAAADTHEAGDQNEAEKSHLRELRPRLC
TMKKGPNGYGFNLHSDKSKPGQFIRAVDPDSPAEASGLRAQDRIVEVNGV
CMEGKQHGDVVSAIKGGGDEAKLLVVDKETDEFFKKCKVIPSQEHLDGPL
PEPFSNGEIQKESSREALVEPASESPRPALARSASSDTSEELNSQDSPKR
QVSTEPSSTSSSSSDPILDLNISLAVAKERAHQKRSSKRAPQMDWSKKNE
LFSNL