mouse ( Mus musculus )
Cytoglobin

Western result: ++

GST GST-Cytoglobin (Cgb) A0023 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Cytoglobin (Cgb)
CBI Antibody Core Code: A0023
"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: 100% (NP_084482.1| cytoglobin; histoglobin; stellate cell activation associated protein)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
TVVENLHDPDKVSSVLALVGKAHALKHKVEPMYFKILSGV
ILEVIAEEFANDFPVETQKAWAKLRGLIYSHVTAAYKEVG
WVQQVPNTTTPPATLPSSGP

Antibody Name/Abbreviation: Cygb-FL
CBI Antibody Core Code: A0996a
"Lot" Number: 1 Position: Full-length
% Identical Homology of Target to Mouse Protein: 91% (NP_084482.1| cytoglobin; histoglobin; stellate cell activation associated protein)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
To be posted

Antibody Name/Abbreviation: Cygb-FL
CBI Antibody Core Code: A0996b
"Lot" Number: 1 Position: Full-length
% Identical Homology of Target to Mouse Protein: 91% (NP_084482.1| cytoglobin; histoglobin; stellate cell activation associated protein)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
To be posted

Sequence Name: Cytoglobin
Full name: Cytoglobin
UniGene Number: N.A.
Accession Number: NM_030206
Source organism: mouse ( Mus musculus )
Full length size (aa): 190
NCBI information page: click here

Sequence Notes: Cygb; Alternative Accession number: AJ315164.1

Full length sequence:
mekvpgdmeierrerseelseaerkavqatwarlyancedvgvailvrff
vnfpsakqyfsqfrhmedplemerspqlrkhacrvmgalntvvenlhdpd
kvssvlalvgkahalkhkvepmyfkilsgvileviaeefandfpvetqka
waklrgliyshvtaaykevgwvqqvpntttppatlpssgp