mouse ( Mus musculus )
mATF1-20

Western result: +

GST GST-mATF1 A0319 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: mATF1
CBI Antibody Core Code: A0319
"Lot" Number: 1 Position: 100(1-100)
% Identical Homology of Target to Mouse Protein: 81% (NP_031523.2| activating transcription factor 1)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
MEDSHKSNTTETASQPGSTVAGPHVSQIVHQVSSLSESEE
SQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRK
GEGENPSISAITSMSVPAPI

Western result: +/-

control mATF1-20 A0320 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: mATF1-20
CBI Antibody Core Code: A0320
"Lot" Number: 1 Position: 20(1-20)
% Identical Homology of Target to Mouse Protein: 100% (NP_031523.2| activating transcription factor 1)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
MEDSHKSNTTETASQPGSTV

Sequence Name: mATF1-20
Full name: Activating transcription factor 1
UniGene Number: N.A.
Accession Number: NP_031523
Source organism: mouse ( Mus musculus )
Full length size (aa): 269
NCBI information page: click here

Full length sequence:
MEDSHKSNTTETASQPGSTVAGPHVSQIVHQVSSLSESEESQDSSDSIGS
SQKAHGILARRPSYRKILKDLSSEDTRGRKGEGENPSISAITSMSVPAPI
YQTSSGQYIAIAPNGALQLASPSTDGVQALQTLTMTNSSSTQQGTILQYA
QTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTL
ASQTTKTDDPQLRREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQN
KTLIEELKTLKDLYSHKSV