Links to multiple antibodies on this page for mATF1-20: mATF1 mATF1-20 Western result: + | | GST
 | GST-mATF1 A0319 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: mATF1 CBI Antibody Core Code: A0319 "Lot" Number: 1 Position: 100(1-100) % Identical Homology of Target to Mouse Protein: 81% (NP_031523.2| activating transcription factor 1) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: MEDSHKSNTTETASQPGSTVAGPHVSQIVHQVSSLSESEE
SQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRK
GEGENPSISAITSMSVPAPI
Western result: +/- | | control
 | mATF1-20 A0320 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: mATF1-20 CBI Antibody Core Code: A0320 "Lot" Number: 1 Position: 20(1-20) % Identical Homology of Target to Mouse Protein: 100% (NP_031523.2| activating transcription factor 1) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: MEDSHKSNTTETASQPGSTV
| | Sequence Name: mATF1-20 Full name: Activating transcription factor 1 UniGene Number: N.A. Accession Number: NP_031523 Source organism: mouse ( Mus musculus ) Full length size (aa): 269 NCBI information page: click here Full length sequence: MEDSHKSNTTETASQPGSTVAGPHVSQIVHQVSSLSESEESQDSSDSIGS
SQKAHGILARRPSYRKILKDLSSEDTRGRKGEGENPSISAITSMSVPAPI
YQTSSGQYIAIAPNGALQLASPSTDGVQALQTLTMTNSSSTQQGTILQYA
QTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTL
ASQTTKTDDPQLRREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQN
KTLIEELKTLKDLYSHKSV
|