Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
hepcidin


Antibody Name/Abbreviation: hepcidin
CBI Antibody Core Code: A1420

"Lot" Number: 1 Position: 54 (20-83)
% Identical Homology of Target to Mouse Protein: 100% (NP_115930.1| hepcidin antimicrobial peptide)
Molecular Weight of fusion protein: 21.04 KDa

Target sequence used to make this antibody:
LSSTTYLHQQMRQTTELQPLHGEESRADIAIPMQKRRKRD
TNFPICIFCCKCCNNSQCGICCKT






Sequence Name: hepcidin
Full name:
UniGene Number: N.A.
Accession Number: BC021587
Source organism: mouse ( Mus musculus )
Full length size (aa): 83
NCBI information page:

Full length sequence:
malstrtqaacllllllaslssttylhqqmrqttelqplhgeesradiai
pmqkrrkrdtnfpicifcckccnnsqcgicckt





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.