| Antibody Name/Abbreviation: hepcidin CBI Antibody Core Code: A1420 "Lot" Number: 1 Position: 54 (20-83) % Identical Homology of Target to Mouse Protein: 100% (NP_115930.1| hepcidin antimicrobial peptide) Molecular Weight of fusion protein: 21.04 KDa Target sequence used to make this antibody: LSSTTYLHQQMRQTTELQPLHGEESRADIAIPMQKRRKRD
TNFPICIFCCKCCNNSQCGICCKT
| | Sequence Name: hepcidin Full name: UniGene Number: N.A. Accession Number: BC021587 Source organism: mouse ( Mus musculus ) Full length size (aa): 83 NCBI information page: Full length sequence: malstrtqaacllllllaslssttylhqqmrqttelqplhgeesradiai
pmqkrrkrdtnfpicifcckccnnsqcgicckt
|