Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
ATPase (Na+/K+ transporting, beta 1 polypeptide


Antibody Name/Abbreviation: Atp1b1
CBI Antibody Core Code: A1285

"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: 87% (NP_033851.1| Na+/K+ -ATPase beta 1 subunit; sodium/potassium ATPase beta subunit)
Molecular Weight of fusion protein: 14.44 KDa

Target sequence used to make this antibody:
To be posted






Sequence Name: ATPase (Na+/K+ transporting, beta 1 polypeptide
Full name: gi|114393|sp|P14094|ATNB_MOUSE Sodium/potassium-transporting ATPase beta-1 chain (Sodium/potassium-dependent ATPase beta-1 subunit
UniGene Number: N.A.
Accession Number: P14094
Source organism: mouse ( Mus musculus )
Full length size (aa): 304
NCBI information page:

Full length sequence:
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIF
IGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEA
YVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCR
FKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYP
LMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKL
LQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKI
EIKS





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.