Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
Local IGF1-EB


Antibody Name/Abbreviation: EB
CBI Antibody Core Code: A1219

"Lot" Number: 1 Position: 25 (135-159)
% Identical Homology of Target to Mouse Protein: 100% (NP_034642.1| insulin-like growth factor 1)
Molecular Weight of GST-fusion: 32.75 KDa

Target sequence used to make this antibody:
SPSLSTNKKTKLQRRRKGSTFEEHK






Sequence Name: Local IGF1-EB
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: mouse ( Mus musculus )
Full length size (aa): 159
NCBI information page:

Full length sequence:
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGP
ETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSC
DLRRLEMYCAPLKPTKAARSIRAQRHTDMPKTQKSPSLSTNKKTKLQRRR
KGSTFEEHK





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.