| Antibody Name/Abbreviation: EB CBI Antibody Core Code: A1219 "Lot" Number: 1 Position: 25 (135-159) % Identical Homology of Target to Mouse Protein: 100% (NP_034642.1| insulin-like growth factor 1) Molecular Weight of GST-fusion: 32.75 KDa Target sequence used to make this antibody: SPSLSTNKKTKLQRRRKGSTFEEHK
| | Sequence Name: Local IGF1-EB Full name: UniGene Number: N.A. Accession Number: N.A. Source organism: mouse ( Mus musculus ) Full length size (aa): 159 NCBI information page: Full length sequence: MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGP
ETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSC
DLRRLEMYCAPLKPTKAARSIRAQRHTDMPKTQKSPSLSTNKKTKLQRRR
KGSTFEEHK
|