mouse ( Mus musculus )
Neurogenin 2

Western result: +

GST GST-Ngn2 A1193a (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Ngn2
CBI Antibody Core Code: A1193a
"Lot" Number: 1 Position: 100 (31-130)
% Identical Homology of Target to Mouse Protein: 76% (NP_033848.1| neurogenin 2; atonal homolog 4 (Drosophila); neurogenin2)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
TPMSSSADEEEDEELRRPGSARGQRGAEAGQGVQGSPASG
AGGCRPGRLLGLMHECKRRPSRSRAVSRGAKTAETVQRIK
KTRRLKANNRERNRMHNLNA

Antibody Name/Abbreviation: Ngn2
CBI Antibody Core Code: A1193b
"Lot" Number: 1 Position: 80 (31-110)
% Identical Homology of Target to Mouse Protein: 70% (NP_033848.1| neurogenin 2; atonal homolog 4 (Drosophila); neurogenin2)
Molecular Weight of fusion protein: 22.8 KDa

Target sequence used to make this antibody:
TPMSSSADEEEDEELRRPGSARGQRGAEAGQGVQGSPASG
AGGCRPGRLLGLMHECKRRPSRSRAVSRGAKTAETVQRIK

Sequence Name: Neurogenin 2
Full name:
UniGene Number: N.A.
Accession Number: BC055743
Source organism: mouse ( Mus musculus )
Full length size (aa): 263
NCBI information page:

Full length sequence:
mfvksetlelkeeeevlmllgsaspasatltpmsssadeeedeelrrpgs
argqrgaeagqgvqgspasgaggcrpgrllglmheckrrpsrsravsrga
ktaetvqrikktrrlkannrernrmhnlnaaldalrevlptfpedakltk
ietlrfahnyiwaltetlrladhcagagglqgalfteavllspgaalgas
gdspsppsswsctnspasssnstspysctlspaspgsdvdywqppppekh
ryaphlplardci