mouse ( Mus musculus )
BLP

Western result: +

control BLP A1116b (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: BLP
CBI Antibody Core Code: A1116b
"Lot" Number: 1 Position: 20 (292-311)
% Identical Homology of Target to Mouse Protein: 100% (XP_487079.1| similar to 4932432N11Rik protein)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
ISSRPKEKPPNQPTHFTDGE

Antibody Name/Abbreviation: BLP
CBI Antibody Core Code: A1116a
"Lot" Number: 2 Position: 100 (517-616)
% Identical Homology of Target to Mouse Protein: 100% (NP_083180.2| RIKEN cDNA 4932432N11)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
GFWGVTAKVSDGTAYLDVDFIDEILTSMIGYSVPEMKQLR
KDPLKYKTFLEGLQKCQRDLIDLCCLMTISYDPSSCKGVV
LELQDVGMEHVENLKKRLNK

Other western:
Code: A1116a
Lot: 1

Western result: +

GST GST-BLP (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Sequence Name: BLP
Full name: Mouse homologue of human Bloom-like protein
UniGene Number: N.A.
Accession Number: N.A.
Source organism: mouse ( Mus musculus )
Full length size (aa): 617
NCBI information page:

Full length sequence:
MSVASAVLRVETWLLATWHVKVPPMWLEACVNWIQEENNNATLSQAQINK
QVLEQWLLTDLRDLEHPLLPDDVLELPKGELNGFYALQINSLVDVSQPAY
SQIQKLRGKNTTNDLVSAETQSTPKPWEVRPSRMLMLQLTDGVTHIQGME
YQSIPALHSGLPPGTKILVHGCILFRLGVLLLKPENVKVLGGEVDGLSEE
NAQEKVLARLIGELDPTVPVIPNNSIHNVPKVSGGLDAVLGPSDEELLAS
LGESEESAANNDVAMERSCFSTGTSSNTTPTNPSGFEPGCNISSRPKEKP
PNQPTHFTDGEFDDFSLEEALLLEETVQKEQMETKASQPLTLKENTGKCM
EIFSHKPSSLNHTALIHKQGNSNFDEKTSEQMIHEDKFFDCASTRNHHKR
FSAHDFTNDSEISEVDDAAQQTLSSSNVHCLRNKILNRKLDLSEKSSQIS
KENGHPFQACSSRSFENNTYLSIGMDLHSPPFIYLSVLMARKPKEVTTVT
VKAFIVTLTGNLSSSGGFWGVTAKVSDGTAYLDVDFIDEILTSMIGYSVP
EMKQLRKDPLKYKTFLEGLQKCQRDLIDLCCLMTISYDPSSCKGVVLELQ
DVGMEHVENLKKRLNK