mouse ( Mus musculus )
C13mt

Western result: +

GST GST-C13mt A1074a (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: C13mt
CBI Antibody Core Code: A1074a
"Lot" Number: 1 Position: 100 (3-102)
% Identical Homology of Target to Mouse Protein: 79% (NP_079823.1| RIKEN cDNA 2410017I18)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
SASTNRTKSSAESTLLPSVAEQQERILSLESELPLEEVDD
LPPLSPLQSVSEEEAIQIAAYSPLPISSFTLADYVDHSKT
LQKLVQLGVDLSKIEKHPDA

Western result: +/-

control C13mt A1074b (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: C13mt
CBI Antibody Core Code: A1074b
"Lot" Number: 1 Position: 20 191-210)
% Identical Homology of Target to Mouse Protein: 100% (NP_079823.1| RIKEN cDNA 2410017I18)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
KDLGLEDNQLDTYLTKNYAI

Sequence Name: C13mt
Full name:
UniGene Number: N.A.
Accession Number: NM_025547
Source organism: mouse ( Mus musculus )
Full length size (aa): 412
NCBI information page:

Full length sequence:
mallaqqlprrfnsvkltsfikakqvtkrsaragkavlpgfsaqpllssd
tsflrrgiktyrtlfwnrfhsastnrtkssaestllpsvaeqqerilsle
selpleevddlpplsplqsvseeeaiqiaaysplpissftladyvdhskt
lqklvqlgvdlskiekhpdaanlllrldfekhikqillflkdlglednql
dtyltknyaifsedlenlktrvaylqsknfsktdiarmvknapfllsfsv
erldnrlgffqkelelnvkktrdlvvrlprlltgslepvkenmkvyhlel
gfkhneiqhmvikipkmltankrklteifdyvhnvmniphhiivkfpqlf
ntrvfkikerhlflaylgraqydpakpnyvsldkfvsfpdkifckeiaka
slndfekflktl