Links to multiple antibodies on this page for GSH1: GSH1 GSH1 Antibody Name/Abbreviation: GSH1 CBI Antibody Core Code: A1040a "Lot" Number: 1 Position: 20 (240-259) % Identical Homology of Target to Mouse Protein: 100% (NP_032204.1| genomic screened homeo box 1) Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: DDELPMSPSSSGKDDRDLTV
Antibody Name/Abbreviation: GSH1 CBI Antibody Core Code: A1040b "Lot" Number: 1 Position: 20 (116-135) % Identical Homology of Target to Mouse Protein: 100% (NP_032204.1| genomic screened homeo box 1) Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: AALYQTSYPLPDPRQFHCIS
| | Sequence Name: GSH1 Full name: genomic screened homeo box 1 UniGene Number: N.A. Accession Number: NP_032204 Source organism: mouse ( Mus musculus ) Full length size (aa): 261 NCBI information page: click here Full length sequence: MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHAR
KAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHS
VSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMR
TAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVK
HKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSS
GKDDRDLTVTP
|