Links to multiple antibodies on this page for ASCL3: ASCL3 ASCL3 Antibody Name/Abbreviation: ASCL3 CBI Antibody Core Code: A1039a "Lot" Number: 1 Position: 20 (147-166) % Identical Homology of Target to Mouse Protein: 100% (NP_064435.1| achaete-scute complex homolog-like 3; Ascl3 protein; ICRFP703B1614Q5.4; ICRFP703N2430Q5.4; Ascl3 gene) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: LLYPDESETKKNPRTASCGS
Antibody Name/Abbreviation: ASCL3 CBI Antibody Core Code: A1039b "Lot" Number: 1 Position: 20 (73-92) % Identical Homology of Target to Mouse Protein: 100% (NP_064435.1| achaete-scute complex homolog-like 3; Ascl3 protein; ICRFP703B1614Q5.4; ICRFP703N2430Q5.4; Ascl3 gene) Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: FPFPMPYTNYRRCDYTYGPA
| | Sequence Name: ASCL3 Full name: ASCL3 (SGN1) UniGene Number: N.A. Accession Number: NP_064435 Source organism: mouse ( Mus musculus ) Full length size (aa): 174 NCBI information page: click here Full length sequence: MDTRSYPSPPDRLSVFAESAHLPLSRPFYLDPMVTVHLCPETPVPASYTD
ELPLLPFSSDTLIMNNYGDPYPFPFPMPYTNYRRCDYTYGPAFIRKRNER
ERQRVKCVNEGYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYP
DESETKKNPRTASCGSLDPALRVI
|