mouse ( Mus musculus )
mouse MGC17330-like

Antibody Name/Abbreviation: mouse MGC17330-like
CBI Antibody Core Code: A1004
"Lot" Number: 2 Position: 100 (28-127)
% Identical Homology of Target to Mouse Protein: 100% (NP_835362.2| Hgfl protein; calcineurin-regulated kringle domain protein)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
DNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPSPGNH
NYCRNPDQDPRGPWCYISSETGVPEKRPCEDVSCPETTSQ
APPPSSAMELEEKSGAPGDK

Other western:
Code: A1004
Lot: 1

Western result: +

GST GST-mouse MGC17330-like (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Sequence Name: mouse MGC17330-like
Full name: Mus musculus similar to hypothetical protein MGC17330
UniGene Number: N.A.
Accession Number: XM203485
Source organism: mouse ( Mus musculus )
Full length size (aa): 264
NCBI information page:

Full length sequence:
MLLAWVHTFLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWL
AAQGSRESLTEPSPGNHNYCRNPDQDPRGPWCYISSETGVPEKRPCEDVS
CPETTSQAPPPSSAMELEEKSGAPGDKEAQVFPPANALPARSEAAEVQPV
IGISQLVRMNSKEKKDLGTLGYVLGITMMVIILAIGAGIIVGYTYKRGKD
LKEQHEKKACEREMQRITLPLSAFTNPTCETVDENTIIVHSNQTPADVQE
GSTLLTGQAGTPGA