| Antibody Name/Abbreviation: mouse MGC17330-like CBI Antibody Core Code: A1004 "Lot" Number: 2 Position: 100 (28-127) % Identical Homology of Target to Mouse Protein: 100% (NP_835362.2| Hgfl protein; calcineurin-regulated kringle domain protein) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: DNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPSPGNH
NYCRNPDQDPRGPWCYISSETGVPEKRPCEDVSCPETTSQ
APPPSSAMELEEKSGAPGDK
Other western: Code: A1004 Lot: 1 Western result: + | | GST
 | GST-mouse MGC17330-like (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | |
| | Sequence Name: mouse MGC17330-like Full name: Mus musculus similar to hypothetical protein MGC17330 UniGene Number: N.A. Accession Number: XM203485 Source organism: mouse ( Mus musculus ) Full length size (aa): 264 NCBI information page: Full length sequence: MLLAWVHTFLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWL
AAQGSRESLTEPSPGNHNYCRNPDQDPRGPWCYISSETGVPEKRPCEDVS
CPETTSQAPPPSSAMELEEKSGAPGDKEAQVFPPANALPARSEAAEVQPV
IGISQLVRMNSKEKKDLGTLGYVLGITMMVIILAIGAGIIVGYTYKRGKD
LKEQHEKKACEREMQRITLPLSAFTNPTCETVDENTIIVHSNQTPADVQE
GSTLLTGQAGTPGA
|