mouse ( Mus musculus )
mHCRTR2

Western result: +

GST GST-mHCRTR2 A0992 (fragment)

31.29 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: mHCRTR2
CBI Antibody Core Code: A0992
"Lot" Number: 1 Position: 55 (245-283)
% Identical Homology of Target to Mouse Protein: 100% (NP_945200.1| hypocretin (orexin) receptor 2)
Molecular Weight of fusion protein: 31.29 KDa

Target sequence used to make this antibody:
QIFRKLWCRQIPGTSSVVQRKWKQQQPVSQPRGSGQQSK

Western result: +

control mHCRTR2-pep A0985 (fragment)

29.31 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: mHCRTR2-pep
CBI Antibody Core Code: A0985
"Lot" Number: 1 Position: 20 (263-282)
% Identical Homology of Target to Mouse Protein: 100% (NP_945200.1| hypocretin (orexin) receptor 2)
Molecular Weight of GST-fusion: 29.31 KDa

Target sequence used to make this antibody:
VQRKWKQQQPVSQPRGSGQQS

Sequence Name: mHCRTR2
Full name: Mouse orexin receptor HCRTR2
UniGene Number: N.A.
Accession Number: N.A.
Source organism: mouse ( Mus musculus )
Full length size (aa): 364
NCBI information page:

Full length sequence:
MSSTKLEDSLSRRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHP
KEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLAD
VLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIAL
DRWYAICHPLMFKSTAKRARNSIVVIWIVSCIIMIPQAIVMECSSMLPGL
ANKTTLFTVCDEHWGGEVYPKMYHICFFLVTYMAPLFLMILAYLQIFRKL
WCRQIPGTSSVVQRKWKQQQPVSQPRGSGQQSKARVSAVAAEIKQIRARR
KTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFPH
WLVYANSCCKPNYL