mouse ( Mus musculus )
LC3

Antibody Name/Abbreviation: LC3
CBI Antibody Core Code: A0973
"Lot" Number: 3 Position: 20 (2-21)
% Identical Homology of Target to Mouse Protein: 100% (NP_080436.1| microtubule-associated protein 1 light chain 3 beta)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
PSEKTFKQRRSFEQRVEDVR

Other western:
Code: A0973
Lot: 1

Western result: +

control LC3 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Sequence Name: LC3
Full name: microtubule-associated protein 1 light chain 3
UniGene Number: N.A.
Accession Number: NP_080436
Source organism: mouse ( Mus musculus )
Full length size (aa): 125
NCBI information page:

Full length sequence:
MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKT
KFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE
SERDEDGFLYMVYASQETFGTAMAV