Return to CBI Antibody Core Home Page
  Return to biothreat/emerging pathogens list
    Return to Salmonella ( Salmonella typhimurium ) list


Salmonella ( Salmonella typhimurium )
colanic acid synthesis regulator


Antibody Name/Abbreviation: RcsF
CBI Antibody Core Code: A1416

"Lot" Number: 1 Position: 66 (31-96)
% Identical Homology of Target to Mouse Protein: 31% (XP_486754.1| similar to Muc19 precursor)
Molecular Weight of fusion protein: 21.26 KDa

Target sequence used to make this antibody:
ATPPKAEPEKPKAPRAAPVRIYTNAEDLVGKPFRDLGEVS
GESCQATNQDSPPNIPTARKRMQINA






Sequence Name: colanic acid synthesis regulator
Full name:
UniGene Number: N.A.
Accession Number: NP_459248
Source organism: Salmonella ( Salmonella typhimurium )
Full length size (aa): 134
NCBI information page:

Full length sequence:
MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPRAAPVR
IYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMK
ANAVLLHSCEITSGTPGCYRQAVCIGSALNISAK





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.