Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
ITC4-C

Western result: +

GST GST-ITC4-C (fragment)

30.3 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: ITC4-C
CBI Antibody Core Code: A0920
"Lot" Number: 1 Position: 30(138-167)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of fusion protein: 30.3 KDa

Target sequence used to make this antibody:
VVNDTAPKPNIVEIDLDNDEDDDEDVTDQE

Sequence Name: ITC4-C
Full name: DLS1
UniGene Number: N.A.
Accession Number: NP_012470
Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
Full length size (aa): 167
NCBI information page:

Full length sequence:
mnnetsgketasaplcspklpvekvqriakndpeymdtsddafvatafat
effvqvltheslhrqqqqqqqqvpplpdeltlsyddisaaivhssdghlq
flndvipttknlrllveenrvryttsvmppnevysayvvndtapkpnive
idldndedddedvtdqe