Links to multiple antibodies on this page for IOC4-N: IOC4-N IOC4-C Western result: + | | GST
 | GST-IOC4-N A0926 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: IOC4-N CBI Antibody Core Code: A0926 "Lot" Number: 1 Position: 30(1-30) % Identical Homology of Target to Mouse Protein: 57% (NP_032259.1| hepatoma-derived growth factor-related protein 2) Molecular Weight of fusion protein: 30.3 KDa Target sequence used to make this antibody: MSEAIFQPTDIVLAKVKGFSAWPAMIIPNE
Antibody Name/Abbreviation: IOC4-C CBI Antibody Core Code: A0914 "Lot" Number: 1 Position: 30(446-475) % Identical Homology of Target to Mouse Protein: 44% (NP_031969.1| epidermal growth factor receptor pathway substrate 15; epidermal growth factor pathway substrate 15) Molecular Weight of fusion protein: 30.3 KDa Target sequence used to make this antibody: LEQNMEIEEMDREKPSFSEDVKEEESKVGA
| | Sequence Name: IOC4-N Full name: IOC4 UniGene Number: N.A. Accession Number: NP_013758 Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae ) Full length size (aa): 475 NCBI information page: Full length sequence: mseaifqptdivlakvkgfsawpamiipnelipdnilktkpvsvhkgksg
sdkkanedidadmeseardreqseeeediedfgeseanpekfiiytpvlk
frkndtlkstycvkffcddsyiwvkpmdmkiltsedcrkwlsgkqrknkk
lipayemamrgkngidiwefveygsygkpdeeeyveeeeeenepekkair
ptrsssrqrqkrasetekseggnsnkrkrvtrstrqqaidaseeeeeeee
ekvqeavrkrpqrtktkkvvvsktkpnpktkakkekpkppkpikyhfedd
edwsivglgpqdlsiektmdpiakklsqkknlekhveikldledklagin
kllcdvlcsainqavsikddfeiildelqialdtrgsrnefitifqsnns
lllnfrilfnlrkrelnkwdlwdrfqdifkhiysyqfipdtedwqleqnm
eieemdrekpsfsedvkeeeskvga
|