Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
Ela1

Western result: +

GST GST-Ela1 A1067a (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Ela1
CBI Antibody Core Code: A1067a
"Lot" Number: 1 Position: 100 (115-214)
% Identical Homology of Target to Mouse Protein: 30% (NP_945174.1| step II splicing factor SLU7)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
VKDIRNNKYRIPYRMLYSKYQQEVEKKQEESAERLRLEMQ
KLQQEREKKQTIVVDHTVYFKKRNTKKTTRLHNEPHSQLY
MKSLKDHESRLKHFKDGGFN

Western result: +/-

control Ela1 A1067b (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: Ela1
CBI Antibody Core Code: A1067b
"Lot" Number: 1 Position: 20 (173-192)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
YFKKRNTKKTTRLHNEPHSQ

Sequence Name: Ela1
Full name:
UniGene Number: N.A.
Accession Number: YNL230C
Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
Full length size (aa): 379
NCBI information page:

Full length sequence:
MKSLQTLCEISLMRNHSNIQSVSNVPYHLLKRILQKVKIPQLLKLEKSNV
LLIFDDDELWLEFLRQDFPTNVHEQFVSKRDIICKYYFDFVKENDIELYH
SNQDLLKSCVRQSVVKDIRNNKYRIPYRMLYSKYQQEVEKKQEESAERLR
LEMQKLQQEREKKQTIVVDHTVYFKKRNTKKTTRLHNEPHSQLYMKSLKD
HESRLKHFKDGGFNIAKRHAQRVAFGGQAGGQSSSPKKGPLSIKPEPVKV
NRQMDNVTAEKKDVTQPITPVKKRRSESPSIFLNRKKPALFRPTPKTNAA
GSRPHTTAITNDHRTTSHPYPHKDVVTSISSVTANPVTKGHKKKKSGIFV
RNAGSDGDSFPHVTATGPTTRPYIYEPRK