Links to multiple antibodies on this page for Rad23: yRad23 yRad23 Western result: + | | control
 | yRad23 A1064b (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: yRad23 CBI Antibody Core Code: A1064b "Lot" Number: 1 Position: 20 (341-360) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: GQGEGEGSFQVDYTPEDDQA
Antibody Name/Abbreviation: yRad23 CBI Antibody Core Code: A1064a "Lot" Number: 1 Position: 100 (299-398) % Identical Homology of Target to Mouse Protein: 54% (NP_033036.2| RAD23a homolog) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: EVFVSMLLEAVGDNMQDVMEGADDMVEGEDIEVTGEAAAA
GLGQGEGEGSFQVDYTPEDDQAISRLCELGFERDLVIQVY
FACDKNEEAAANILFSDHAD
| | Sequence Name: Rad23 Full name: UniGene Number: N.A. Accession Number: YEL037C Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae ) Full length size (aa): 398 NCBI information page: Full length sequence: MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKV
LQDSKTVSECGLKDGDQVVFMVSQKKSTKTKVTEPPIAPESATTPGRENS
TEASPSTDASAAPAATAPEGSQPQEEQTATTERTESASTPGFVVGTERNE
TIERIMEMGYQREEVERALRAAFNNPDRAVEYLLMGIPENLRQPEPQQQT
AAAAEQPSTAATTAEQPAEDDLFAQAAQGGNASSGALGTTGGATDAAQGG
PPGSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEV
FVSMLLEAVGDNMQDVMEGADDMVEGEDIEVTGEAAAAGLGQGEGEGSFQ
VDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSDHAD
|