Links to multiple antibodies on this page for MSG5: MSG5 MSG5 Antibody Name/Abbreviation: MSG5 CBI Antibody Core Code: A1057b "Lot" Number: 1 Position: 20 (15-34) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: DIDFKPNSPRSLQNRNTKNL
Antibody Name/Abbreviation: MSG5 CBI Antibody Core Code: A1057a "Lot" Number: 2 Position: 100 (119-218) % Identical Homology of Target to Mouse Protein: 36% (NP_080684.1| synuclein, alpha interacting protein (synphilin); synphilin-1) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: YTKSSTVSSISKLSSSSPLSSFSEKPHLNRVHSLSVKTKD
LKLKGIRGRSQTISGLETSTPISSTREGTLDSTDVNRFSN
QKNMQTTLIFPEEDSDLNID
Other western: Code: A1057a Lot: 1 Western result: + | | | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | |
| | Sequence Name: MSG5 Full name: UniGene Number: N.A. Accession Number: P38590 Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae ) Full length size (aa): 489 NCBI information page: Full length sequence: MQFHSDKQHLDSKTDIDFKPNSPRSLQNRNTKNLSLDIAALHPLMEFSSP
SQDVPGSVKFPSPTPLNLFMKPKPIVLEKCPPKVSPRPTPPSLSMRRSEA
SIYTLPTSLKNRTVSPSVYTKSSTVSSISKLSSSSPLSSFSEKPHLNRVH
SLSVKTKDLKLKGIRGRSQTISGLETSTPISSTREGTLDSTDVNRFSNQK
NMQTTLIFPEEDSDLNIDMVHAEIYQRTVYLDGPLLVLPPNLYLYSEPKL
EDILSFDLVINVAKEIPNLEFLIPPEMAHKIKYYHIEWTHTSKIVKDLSR
LTRIIHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLK
GVAKDISPNMGLIFQLMEWGTMLSKNSPGEEGETVHMPEEDDIGNNEVSS
TTKSYSSASFRSFPMVTNLSSSPNDSSVNSSEVTPRTPATLTGARTALAT
ERGEDDEHCKSLSQPADSLEASVDNESISTAPEQMMFLP
|