Return to CBI Antibody Core Home Page
  Return to yeast list
    Return to Bakers yeast (Yeast) ( Saccharomyces cerevisiae ) list


Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
DIG2


Links to multiple antibodies on this page for DIG2:
DIG2
DIG2


Western result: +
control
DIG2
A1056b
(fragment)

32.2 kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: DIG2
CBI Antibody Core Code: A1056b

"Lot" Number: 1 Position: 20 (5-24)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
EQEDPQQEQISTVQENDPRN






Antibody Name/Abbreviation: DIG2
CBI Antibody Core Code: A1056a

"Lot" Number: 2 Position: 100 (186-285)
% Identical Homology of Target to Mouse Protein: 37% (NP_443737.1| low density lipoprotein-related protein 1B; low density lipoprotein receptor related protein LRP1B/LRP-DIT)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
PTQTHAYEGYYSPMYPGPLYNNGIIPADYHAKRKKLAGRS
PHLEDLTSRKRTFVSKHHNGDPIISKTDEDIECSVTKNSL
SEGASLNDDADDDNDKERII


Other western:
Code: A1056a
Lot: 1


Western result: +
GST
GST-DIG2
(fragment)

25 kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.




Sequence Name: DIG2
Full name:
UniGene Number: N.A.
Accession Number: Q03373
Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae )
Full length size (aa): 323
NCBI information page:

Full length sequence:
MNKEEQEDPQQEQISTVQENDPRNLQQLGMLLVSPGLDEDRLSEKMISKI
KKSRDIEKNQKLLISRLSQKEEDHSGKPPTITTSPAEKTVPFKSLNHSLK
RKRVPPALNFSDIQASSHLHGSKSAPPNITRFPQHKNSLRVRYMGRMAPT
NQDYHPSVANSYMTATYPYPYTGLPPVPCYPYSSTPTQTHAYEGYYSPMY
PGPLYNNGIIPADYHAKRKKLAGRSPHLEDLTSRKRTFVSKHHNGDPIIS
KTDEDIECSVTKNSLSEGASLNDDADDDNDKERIIIGEISLYDDVFKFEV
RDDKNDYMKACETIWTEWHNLKK





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.