Links to multiple antibodies on this page for STE50: STE50 STE50 STE50 Western result: + | | control
 | STE50 A1054b (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: STE50 CBI Antibody Core Code: A1054b "Lot" Number: 1 Position: 20 (187-206) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: YFDTVHNRQSPSRRESPVTV
Antibody Name/Abbreviation: STE50 CBI Antibody Core Code: A1054a "Lot" Number: 2 Position: 100 (233-332) % Identical Homology of Target to Mouse Protein: 30% (NP_036114.1| homer homolog 3; homer, neuronal immediate early gene, 3) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: QSHPSAVSTANTPGPSPNEALKQLRASKEDSCERILKNAM
KRHNLADQDWRQYVLVICYGDQERLLELNEKPVIIFKNLK
QQGLHPAIMLRRRGDFEEVA
Antibody Name/Abbreviation: STE50 CBI Antibody Core Code: A1054a "Lot" Number: 2 Position: 100 (233-332) % Identical Homology of Target to Mouse Protein: 30% (NP_036114.1| homer homolog 3; homer, neuronal immediate early gene, 3) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: QSHPSAVSTANTPGPSPNEALKQLRASKEDSCERILKNAM
KRHNLADQDWRQYVLVICYGDQERLLELNEKPVIIFKNLK
QQGLHPAIMLRRRGDFEEVA
| | Sequence Name: STE50 Full name: UniGene Number: N.A. Accession Number: P25344 Source organism: Bakers yeast (Yeast) ( Saccharomyces cerevisiae ) Full length size (aa): 346 NCBI information page: Full length sequence: MEDGKQAINEGSNDASPDLDVNGTILMNNEDFSQWSVDDVITWCISTLEV
EETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMR
DSKLEWKDDKTQEDMITVLKNLYTTTSAKLQEFQSQYTRLRMDVLDVMKT
SSSSSPINTHGVSTTVPSSNNTIIPSSDGVSLSQTDYFDTVHNRQSPSRR
ESPVTVFRQPSLSHSKSLHKDSKNKVPQISTNQSHPSAVSTANTPGPSPN
EALKQLRASKEDSCERILKNAMKRHNLADQDWRQYVLVICYGDQERLLEL
NEKPVIIFKNLKQQGLHPAIMLRRRGDFEEVAMMNGSDNVTPGGRL
|