| Antibody Name/Abbreviation: ICER CBI Antibody Core Code: A0323 "Lot" Number: 1 Position: 20(1-20) % Identical Homology of Target to Mouse Protein: 91% (NP_038526.1| cAMP responsive element modulator) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: MAVTGDETDEETDLAPSHMA
| | Sequence Name: ICER Full name: UniGene Number: N.A. Accession Number: S36885 Source organism: Norway rat (Rat) ( Rattus norvegicus ) Full length size (aa): 120 NCBI information page: click here Full length sequence: MAVTGDETDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGS
LHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQ
NKKLIEELETLKDICSPKTD
|