Return to CBI Antibody Core Home Page
  Return to other mammals list
    Return to Norway rat (Rat) ( Rattus norvegicus ) list


Norway rat (Rat) ( Rattus norvegicus )
ICER


Antibody Name/Abbreviation: ICER
CBI Antibody Core Code: A0323

"Lot" Number: 1 Position: 20(1-20)
% Identical Homology of Target to Mouse Protein: 91% (NP_038526.1| cAMP responsive element modulator)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
MAVTGDETDEETDLAPSHMA






Sequence Name: ICER
Full name:
UniGene Number: N.A.
Accession Number: S36885
Source organism: Norway rat (Rat) ( Rattus norvegicus )
Full length size (aa): 120
NCBI information page: click here

Full length sequence:
MAVTGDETDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGS
LHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQ
NKKLIEELETLKDICSPKTD





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.