Links to multiple antibodies on this page for pfTBP: pfTBP pfTBP Western result: + | | GST
 | GST-pfTBP A1115a (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: pfTBP CBI Antibody Core Code: A1115a "Lot" Number: 1 Position: 100 (75-174) % Identical Homology of Target to Mouse Protein: 36% (NP_038712.1| TATA box binding protein) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: RNAEYNPSKINTLIIRLNKPQCTALIFKNGRIMLTGTRTK
KDSIMGCKKIAKIIKIVTKDKVKFCNFKIENIIASANCNI
PIRLEVLAHDHKEYCNYEPE
Antibody Name/Abbreviation: pfTBP CBI Antibody Core Code: A1115b "Lot" Number: 1 Position: 20 (24-43) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: YTSEYDNNEKEKSDDLKNKL
| | Sequence Name: pfTBP Full name: TATA-binding protein (TFIID component) UniGene Number: N.A. Accession Number: AAA29769 Source organism: malaria parasite (malaria (P. falciparum)) ( Plasmodium falciparum ) Full length size (aa): 228 NCBI information page: Full length sequence: MNFLEQDQLFLENINQDNVVSAHYTSEYDNNEKEKSDDLKNKLVHKNISL
NIHNIISSANLCIDINLRLVAVSIRNAEYNPSKINTLIIRLNKPQCTALI
FKNGRIMLTGTRTKKDSIMGCKKIAKIIKIVTKDKVKFCNFKIENIIASA
NCNIPIRLEVLAHDHKEYCNYEPELFAGLVYRYKPTSNLKSVILIFVSGK
IIITGCKSVNKLYTVFQDIYNVLIQYKN
|