Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to deer mouse ( Peromyscus maniculatus ) list


deer mouse ( Peromyscus maniculatus )
IL4


Antibody Name/Abbreviation: IL4
CBI Antibody Core Code: A0870

"Lot" Number: 1 Position: 20(128-147)
% Identical Homology of Target to Mouse Protein: 52% (NP_075630.1| torsin family 3, member A; ATP-dependant interferon responsive)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
MESLRRTMQKKYWQCGSSTF






Sequence Name: IL4
Full name: Interleukin 4
UniGene Number: N.A.
Accession Number: N.A.
Source organism: deer mouse ( Peromyscus maniculatus )
Full length size (aa): 147
NCBI information page:

Full length sequence:
MGLSPQLAAILLWLLACTGHYTLGCNDKALKEIIHILNQVTEKGTPCTEM
VVPDVLTARKNTTEKELICRASQVLRKFYFPHEVTPCLKNNSGVLKALKR
LHRGISNLSPQKSCTGNESTHTTLKDFMESLRRTMQKKYWQCGSSTF





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.