Links to multiple antibodies on this page for RV1478: RV1478 RV1478 Antibody Name/Abbreviation: RV1478 CBI Antibody Core Code: A1441 "Lot" Number: 1 Position: 32 (56-87) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of fusion protein: 17.52 KDa Target sequence used to make this antibody: ANASLQATAQATQTTLDLGRQFLGGLGINLGG
Antibody Name/Abbreviation: RV1478 CBI Antibody Core Code: A1441rat "Lot" Number: 1 Position: To be posted % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of fusion protein: 14.44 KDa Target sequence used to make this antibody: To be posted
| | Sequence Name: RV1478 Full name: UniGene Number: N.A. Accession Number: N.A. Source organism: Tuberculosis (Mtb strain H37Rv) ( Mycobacterium tuberculosis H37Rv ) Full length size (aa): 241 NCBI information page: Full length sequence: MRHTRFHPIKLAWITAVVAGLMVGVATPADAEPGQWDPTLPALVSAGAPG
DPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGA
SRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGPSKGVDSGANTVGF
DCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGGGQ
HVTLYLGNGQMLEASGSAGKVTVSPVRKAGMTPFVTRIIEY
|